Recombinant Human Prostaglandin E Synthase / MPGES-1 protein (ab160537)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDA LRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAW MHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAAR HL
    • Amino acids
      1 to 152
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Prostaglandin E Synthase

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glutathione S transferase 1 like 1
    • MGC10317
    • MGST IV
    • MGST1 L1
    • MGST1 like 1
    • MGST1-L1
    • MGST1L1
    • MGSTIV
    • Microsomal glutathione S transferase 1 like 1
    • Microsomal glutathione S-transferase 1-like 1
    • Microsomal prostaglandin E synthase 1
    • Microsomal prostaglandin E synthase 1
    • MPGES
    • mPGES 1
    • mPGES-1
    • p53 induced apoptosis protein 12
    • p53 induced gene 12
    • p53 induced gene 12 protein
    • p53-induced gene 12 protein
    • PGES
    • PIG 12
    • PIG12
    • PP 102
    • PP 1294
    • PP102
    • PP1294
    • Prostaglandin E synthase
    • PTGES
    • PTGES_HUMAN
    • TP53I12
    • Tumor protein p53 inducible protein 12
    see all
  • Function
    Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2).
  • Sequence similarities
    Belongs to the MAPEG family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160537 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up