Recombinant Human Prostate Specific Antigen protein (ab151676)

Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCI RNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDS SHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLT PKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPL VCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPVDHHHH HH
    • Molecular weight

      27 kDa
    • Amino acids

      18 to 261
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab151676 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from a 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 6.00
    Constituents: 0.39% MES, 0.02% Calcium chloride, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • antigen, prostate-specific
    • APS
    • Gamma seminoprotein
    • Gamma-seminoprotein
    • hK3
    • Kallikrein 3
    • Kallikrein related peptidase 3
    • Kallikrein-3
    • KLK 3
    • KLK2A1
    • Klk3
    • KLK3_HUMAN
    • P-30 antigen
    • P30 antigen
    • Prostate-specific antigen
    • Psa
    • Semenogelase
    • Seminin
    see all
  • Function

    Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151676 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Sandwich ELISA
I bought Recombinant Human Prostate Specific Antigen protein (ab151676) for sandwich ELISA detection. I used ab10187 as capture antibody and ab182031 as detection antibody. But the results were not good, I can not get a obvious signal below 10 ng/mL concentration.
Technique support from Abcam told me that the problem in my experiment is because of the PSA protein I used. ab151676 has not been validated for ELISA. It was validated as a SDS-PAGE/HPLC positive control and might not even be natively folded. They recommended Natural Human Prostate Specific Antigen protein (ab167932) to me, which has been tested in ELISA. Thanks a lot for the helpful advice from Scientific Support of Abcam!

Abcam user community

Verified customer

Submitted Sep 08 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up