Description

  • Product name

    Recombinant Human Proteasome 19S S5A/ASF protein
    See all Proteasome 19S S5A/ASF proteins and peptides
  • Purity

    = 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVG LITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHR QGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNT EKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLG ASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIAT TGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF GQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE AIRNAMGSLASQATKDGKKDKKEEDKK
    • Predicted molecular weight

      42 kDa
    • Amino acids

      1 to 377
    • Additional sequence information

      NM_002810.

Specifications

Our Abpromise guarantee covers the use of ab207984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Proteasome 19S S5A. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 10% Glycerol, 0.02% Beta mercaptoethanol, 0.87% Sodium chloride

General Info

  • Alternative names

    • 26S protease subunit S5a
    • 26S proteasome non ATPase regulatory subunit 4
    • 26S proteasome non-ATPase regulatory subunit 4
    • 26S proteasome regulatory subunit rpn10
    • 26S proteasome regulatory subunit S5A
    • AF
    • AF 1
    • AF1
    • Angiocidin
    • Antisecretory factor 1
    • ASF
    • DS5a
    • MCB 1
    • MCB1
    • Multiubiquitin chain binding protein
    • Multiubiquitin chain-binding protein
    • OTTHUMP00000059963
    • Prosome macropain
    • Proteasome (prosome macropain) 26S subunit non ATPase 4
    • Proteasome 19S S5A
    • Proteasome 26S non ATPase subunit 4
    • Proteasome 26S subunit non ATPase 4
    • PSMD 4
    • Psmd4
    • PSMD4_HUMAN
    • pUB R5
    • pUBR5
    • Rpn 10
    • Rpn10
    • RPN10 homolog
    • S5A
    • S5a/antisecretory factor protein
    see all
  • Function

    Binds and presumably selects ubiquitin-conjugates for destruction. Displays selectivity for longer polyubiquitin chains. Modulates intestinal fluid secretion.
  • Sequence similarities

    Belongs to the proteasome subunit S5A family.
    Contains 2 UIM (ubiquitin-interacting motif) repeats.
    Contains 1 VWFA domain.
  • Domain

    The 2 UIM motifs are involved in the binding to a multi-ubiquitin chain in a cooperative way.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • Coomassie stained SDS-PAGE analysis of 5 μg ab207984.

References

ab207984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up