Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMTTTLAFKFQHGVIAAVDSRASAGSY ISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERIS VSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNM FSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVN MYHMKEDGWVKVESTDVSDLLHQYREANQ
    • Molecular weight

      25 kDa including tags
    • Amino acids

      73 to 276
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • ALDD
    • D6S216
    • D6S216E
    • Large multifunctional peptidase 7
    • Large multifunctional protease 7
    • LMP 7
    • LMP7
    • Low molecular mass protein 7
    • Low molecular weight protein 7
    • Macropain subunit C13
    • MGC1491
    • Multicatalytic endopeptidase complex subunit C13
    • NKJO
    • OTTHUMP00000062981
    • Protease component C13
    • Proteasome (prosome macropain) subunit beta type 8
    • Proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
    • Proteasome beta 8 subunit
    • Proteasome catalytic subunit 3i
    • Proteasome component C13
    • Proteasome related gene 7
    • Proteasome subunit beta 5i
    • Proteasome subunit beta 8
    • Proteasome subunit beta type
    • Proteasome subunit beta type 8
    • Proteasome subunit beta type-8
    • Proteasome subunit beta-5i
    • Proteasome subunit Y2
    • PSB8_HUMAN
    • PSMB 8
    • PSMB5i
    • PSMB8
    • Really interesting new gene 10 protein
    • RING 10
    • RING10
    • Y2
    see all
  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency.
  • Involvement in disease

    Defects in PSMB8 are the cause of JMP syndrome (JMPS) [MIM:613732]; also called joint contractures muscular atrophy microcytic anemia and panniculitis-induced lipodystrophy. JBTS1 is an autoinflammatory disorder characterized by childhood onset of joint stiffness and severe contractures of the hands and feet, erythematous skin lesions with subsequent development of severe lipodystrophy, and laboratory evidence of immune dysregulation. Accompanying features include muscle weakness and atrophy, hepatosplenomegaly, and microcytic anemia.
  • Sequence similarities

    Belongs to the peptidase T1B family.
  • Developmental stage

    Highly expressed in immature dendritic cells (at protein level).
  • Post-translational
    modifications

    Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137150.

References

ab137150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up