Recombinant Human Proteasome 20S LMP7 protein (Tagged) (ab236180)
Key features and details
- Expression system: Escherichia coli
- Purity: > 85% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Proteasome 20S LMP7 protein (Tagged)
See all Proteasome 20S LMP7 proteins and peptides -
Purity
> 85 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
TTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAA DCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSM ICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPE EAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYR EANQ -
Predicted molecular weight
43 kDa including tags -
Amino acids
73 to 276 -
Tags
His tag N-Terminus -
Additional sequence information
This product is the mature full length protein from aa 73 to 276. The propeptide is not included. N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.
-
Associated products
-
Related Products
- Anti-Proteasome 20S LMP7 antibody [EPR14482(B)] (ab180606)
- Anti-6X His tag® antibody [HIS.H8] (ab18184)
- Anti-Myc tag antibody [Myc.A7] (ab18185)
- Anti-Proteasome 20S LMP7 antibody (ab232984)
- Anti-Proteasome 20S LMP7 antibody (ab3329)
- Anti-6X His tag® antibody [4D11] (ab5000)
- Anti-Myc tag antibody (ab9106)
- Anti-6X His tag® antibody (ab9108)
- Anti-Myc tag antibody - ChIP Grade (ab9132)
Specifications
Our Abpromise guarantee covers the use of ab236180 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- ALDD
- D6S216
- D6S216E
see all -
Function
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. -
Involvement in disease
Defects in PSMB8 are the cause of JMP syndrome (JMPS) [MIM:613732]; also called joint contractures muscular atrophy microcytic anemia and panniculitis-induced lipodystrophy. JBTS1 is an autoinflammatory disorder characterized by childhood onset of joint stiffness and severe contractures of the hands and feet, erythematous skin lesions with subsequent development of severe lipodystrophy, and laboratory evidence of immune dysregulation. Accompanying features include muscle weakness and atrophy, hepatosplenomegaly, and microcytic anemia. -
Sequence similarities
Belongs to the peptidase T1B family. -
Developmental stage
Highly expressed in immature dendritic cells (at protein level). -
Post-translational
modificationsAutocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab236180 has not yet been referenced specifically in any publications.