Overview

  • Product name

    Recombinant Human Proteasome subunit alpha type 6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMSRGSSAGFDRHITIFSPEGRLYQVE YAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENI GCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYT QNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTEST SFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPK FRILTEAEIDAHLVALAERD
    • Molecular weight

      30 kDa including tags
    • Amino acids

      1 to 246
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab117226 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 40% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 27 kDa prosomal protein
    • IOTA
    • Macropain iota chain
    • Macropain subunit iota
    • MGC22756
    • MGC2333
    • MGC23846
    • Multicatalytic endopeptidase complex iota chain
    • p27K
    • PROS 27
    • PROS-27
    • PROS27
    • Prosomal P27K protein
    • Proteasome (prosome macropain) subunit alpha type 6
    • Proteasome iota chain
    • Proteasome subunit alpha type 6
    • Proteasome subunit alpha type-6
    • Proteasome subunit iota
    • PSA6_HUMAN
    • PSMA 6
    • PSMA6
    see all
  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
  • Sequence similarities

    Belongs to the peptidase T1A family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab117226 at approximately 29.9kDa (3µg).

References

ab117226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up