Recombinant human Protein C inhibitor (Active) (ab229370)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMHRHHPREMKKRVEDLHVGATVAPSSRRDF TFDLYRALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLN LQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSA MKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVI MVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDR NLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQ LELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMV HKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNIL FLGKVNRP
    • Molecular weight
      46 kDa including tags
    • Amino acids
      20 to 406
    • Tags
      His tag N-Terminus
    • Additional sequence information
      This product is the full length protein from aa 20 to 406 including the propeptide. The signal peptide is not included (AAH08915).

Specifications

Our Abpromise guarantee covers the use of ab229370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to inhibit Thrombin cleavage of substrate Boc-VPR-AMC. The IC50 for this effect is less or equal to 2 nM.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab229370 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 6.00
    Constituents: 0.39% MES, 0.87% Sodium chloride, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Acrosomal serine protease inhibitor
    • IPSP
    • IPSP_HUMAN
    • PAI 3
    • PAI-3
    • PAI3
    • PCI
    • PCI-B
    • PLANH 3
    • PLANH3
    • Plasma serine protease inhibitor
    • Plasminogen activator inhibitor 3
    • Plasminogen activator inhibitor III
    • PROCI
    • Protein C inhibitor
    • Serpin A5
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 5
    • Serpin peptidase inhibitor clade A member 5
    • Serpina5
    see all
  • Function
    Inhibits activated protein C as well as plasminogen activators.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Belongs to the serpin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab229370.

References

ab229370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up