Overview

  • Product name
    Recombinant Human Protein cornichon homolog 2
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARA RERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFY HLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYL YSMVYTLVSF
    • Amino acids
      1 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CNI like
    • CNIH 2
    • CNIH2
    • CNIH2_HUMAN
    • Cnih3
    • Cnil
    • Cornichon homolog 2
    • Cornichon homolog 2 (Drosophila)
    • Cornichon like protein
    • Cornichon, Drosophila, homolog of, 2
    • Cornichon-like protein
    • Protein cornichon homolog 2
    • RGD1304930
    see all
  • Function
    Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivation and desensitization. Blocks CACNG8-mediated resensitization of AMPA receptors.
  • Sequence similarities
    Belongs to the cornichon family.
  • Cellular localization
    Endoplasmic reticulum membrane. Cell junction > synapse > postsynaptic cell membrane. Cell projection > dendrite. Cell projection > dendritic spine. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Also localizes to the cell membrane of extrasynaptic sites (dendritic shafts, spines of pyramidal cells).
  • Information by UniProt

Images

  • ab166032 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166032 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166032.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up