Recombinant Human Protein kinase-like protein SgK493 (ab164858)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSW EDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDA RVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFT YLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQ NSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCES HAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG
    • Amino acids
      1 to 294
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ18197
    • Hypothetical protein BC007901
    • Hypothetical protein LOC91461
    • MGC125960
    • Pkdcc
    • PKDCC_HUMAN
    • Protein kinase domain containing cytoplasmic
    • Protein kinase domain containing, cytoplasmic homolog (mouse)
    • Protein kinase domain-containing protein, cytoplasmic
    • Protein kinase-like protein SgK493
    • SGK493
    • Sugen kinase 493
    • Vertebrate lonesome kinase
    • Vlk
    see all
  • Function
    Protein kinase which is required for longitudinal bone growth through regulation of chondrocyte differentiation. Involved in protein transport from the Golgi apparatus to the plasma membrane.
  • Sequence similarities
    Belongs to the protein kinase superfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Golgi apparatus.
  • Information by UniProt

Images

  • ab164858 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up