Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD ALVTMGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRRKQEQHVHNEKSV LKEVSHPFLIRLFWTWHEERFLYMLMEYVPGGELFSYLRNRGHFSSTTGL FYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDR TWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPF GIYQKILAGKLYFPRHLDFHVKTGRMM
    • Amino acids

      1 to 277
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159225 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • PRKXP3
    • PRKYP
    • Protein kinase Y linked pseudogene
    • Protein kinase, Y linked
    • Serine/threonine protein kinase PRKY
    see all
  • Relevance

    This gene encodes a member of the cAMP dependent serine/threonine protein kinase family. This gene is located on chromosome Y, near the boundary of the pseudoautosomal region. Abnormal recombination between this gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [Entrez Gene]

Images

  • ab159225 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159225 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159225.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up