Overview

  • Product name

    Recombinant Human Protein kinase Y linked
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      EAPAYRLQDCDALVTMGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRRK QEQHVHNEKSVLKEVSHPFLIRLFWTWHEERFLYMLMEYVPGGELFSYLR NRGHFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLT DFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLS GFPPFFDDNPFGIYQKILAGKLYFPRHLDFHVKTGRMM
    • Molecular weight

      53 kDa including tags
    • Amino acids

      40 to 277
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      BC074852

Specifications

Our Abpromise guarantee covers the use of ab179953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity

    > 75 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 25% Glycerol, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.29% Sodium chloride, 0.002% PMSF, 0.79% Tris HCl

General Info

  • Alternative names

    • PRKXP3
    • PRKYP
    • Protein kinase Y linked pseudogene
    • Protein kinase, Y linked
    • Serine/threonine protein kinase PRKY
    see all
  • Relevance

    This gene encodes a member of the cAMP dependent serine/threonine protein kinase family. This gene is located on chromosome Y, near the boundary of the pseudoautosomal region. Abnormal recombination between this gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [Entrez Gene]

Images

  • SDS-PAGE analysis of ab179953.

References

ab179953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up