Description

  • Product name

    Recombinant Human Prothrombin protein (His tag)
    See all Prothrombin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QHVFLAPQQARSLLQRVRRANTFLEEVRKGNLERECVEETCSYEEAFEAL ESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNITR SGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDP TVRRQECSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGR LAVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGAWC YVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFF NPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGRIVEGSDAEIGM SPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLV RIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAF SDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQ VVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVM KSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      25 to 622
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 622 including the propeptide. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab223102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.No activity loss was observed after storage at: In lyophilized state for 1 year (4degC); After reconstitution under sterile conditions for 3 months (-70degC).

General Info

  • Alternative names

    • Coagulation factor II
    • coagulation factor II (thrombin)
    • F2
    • Factor II
    • Prepro coagulation factor II
    • Prothrombin
    • prothrombin B-chain
    • PT
    • RPRGL2
    • serine protease
    • THPH1
    • THRB
    • THRB_HUMAN
    • Thrombin heavy chain
    see all
  • Function

    Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Defects in F2 are the cause of factor II deficiency (FA2D) [MIM:613679]. It is a very rare blood coagulation disorder characterized by mucocutaneous bleeding symptoms. The severity of the bleeding manifestations correlates with blood factor II levels.
    Genetic variations in F2 may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
    Defects in F2 are a cause of susceptibility to thrombosis (THR) [MIM:188050]. It is a multifactorial disorder of hemostasis characterized by abnormal platelet aggregation in response to various agents and recurrent thrombi formation. Note=A common genetic variation in the 3-prime untranslated region of the prothrombin gene is associated with elevated plasma prothrombin levels and an increased risk of venous thrombosis.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
    Contains 2 kringle domains.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    The gamma-carboxyglutamyl residues, which bind calcium ions, result from the carboxylation of glutamyl residues by a microsomal enzyme, the vitamin K-dependent carboxylase. The modified residues are necessary for the calcium-dependent interaction with a negatively charged phospholipid surface, which is essential for the conversion of prothrombin to thrombin.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab223102 analyzed by DTT-reduced SDS-PAGE and Coomassie Blue staining.

    ab223102 has a calculated MW of 69.5 kDa, but migrates as 85-110 kDa in SDS-PAGE under reducing conditions due to glycosylation.

References

ab223102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up