Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRRCRWAALALGLLRLCLAQANFAPHFFDNGVGSTNGNMALFSLPEDTPV GSHVYTLNGTDPEGDPISYHISFDPSTRSVFSVDPTFGNITLVEELDRER EDEIEAIISISDGLNLVAEKVVILVTDANDEAPRFIQEPYVALVPEDIPA GSIIFKVHAVDRDTGSGGSVTYFLQNLHSPFAVDRHSGVLRLQAGATLDY ERSRTHYITVVAKDGGGRLHGADVVFSATTTVTVNVEDVQDMAPVFVGTP YYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSG AISITQSPAQLQREVYELHVQVTEMSPAGSPAAQATVPVTIRIVDLNNHP PTFYGESGPQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLV GPRGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKVLTFKLLAVEVNTPE KFSSTADVVIQLLDTNDNVPKFDSLYYVARIPENAPGGSSVVAVTAVDPD TGPWGEVKYSTYGTGADLFLIHPSTGLIYTQPWASLDAEATARYNFYVKA EDMEGKYSVAEVFITLLDVNDHPPQFGKSVQKKTMVLGTPVKIEAIDEDA EEPNNLVDYSITHAEPANVFDINSHTGEIWLKNSIRSLDALHNITPGRDC LWSLEVQAKDRGSPSFSTTALLKIDITDAEVRRLRYMKNSNFPGTTKSVR KPKFKPKKPHSSQGLFLHPHCEIALFNLSNVNLYSRVFQGAAQAS
    • Amino acids
      1 to 745
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cadherin-related family member 1
    • CDHR1
    • CDHR1_HUMAN
    • CORD15
    • DKFZp434A132
    • KIAA1775
    • MT protocadherin
    • PCDH 21
    • PCDH21
    • PCDH21 protein
    • Photoreceptor cadherin
    • prCAD
    • Protocadherin-21
    • RP65
    see all
  • Function
    Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells.
  • Sequence similarities
    Contains 6 cadherin domains.
  • Post-translational
    modifications
    Undergoes proteolytic cleavage; produces a soluble 95 kDa N-terminal fragment and a 25 kDa cell-associated C-terminal fragment.
  • Cellular localization
    Cell membrane. Localized at the junction between the inner and outer segments of rod and cone photoreceptors cells. Confined to the base of the OS. Localized on the edges of nascent evaginating disks on the side of the OS opposite the connecting cilium. Expressed at postnatal day 2 at the apical tip of the rod photoreceptor cells, the site of the developing OS. Colocalized with rhodopsin between postnatal days 2 and 9 at the base of the growing OS region.
  • Information by UniProt

Images

  • ab164895 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up