Description

  • Product name

    Recombinant Human Protocadherin beta 12 protein
  • Purity

    > 90 % SDS-PAGE.
    Expressed in E.coli as inclusion bodies. The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVK DALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSE EGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSG GSHHHHHHGSENLYFQGSGSETGNFLVMEELQSGSFVGNLAKTLGLEVSE LSSRGARVVSNDNKECLQLDTNTGDLLLREMLDREELCGSNEPCVLYFQV LMKNPTQFLQIELQVRDINDHSPVFLEKEMLLEIPENSPVGAVFLLESAK DLDVGINAVKSYTINPNSHFHVKIRVNPDNRKYPELVLDKALDYEERPEL SFILTALDGGSPPRSGTALVRVVVVDINDNSPEFEQAFYEVKILENSILG SLVVTVSAWDLDSGTNSELSYTFSHASEDIRKTFEINQKSGDITLTAPLD FEAIESYSIIIQATDGGGLFGKSTVRIQVMDVNDNAPEITVSSITSPIPE NTPETVVMVFRIRDRDSGDNGKMVCSIPEDIPFVLKSSVNNYYTLETERP LDRESRAEYNITITVTDLGTPRLKTEHNITVLVSDVNDNAPAFTQTSYAL FVRENNSPALHIGSISATDRDSGTNAQVNYSLLPSQDPHLPLASLVSINA DNGHLFALRSLDYEALQGFQFRVGATDHGSPALSSEALVRVLVLDANDNS PFVLYPLQNGSAPCTELVPWAAEPGYLVTKVVAVDGDSGQNAWLSYQLLK ATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATL HVLLVDGFSQPYLPLPEAAPAQAQADSLTVYL
    • Predicted molecular weight

      97 kDa including tags
    • Amino acids

      27 to 690
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Constructed with codon optimization and expressed with a human Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site (219aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab199594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • PCDBC_HUMAN
    • PCDH beta12
    • PCDH-beta-12
    • PCDHB 12
    • PCDHB12
    • Protocadherin beta-12
    see all
  • Function

    Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.
  • Sequence similarities

    Contains 6 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab199594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up