For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-prp19-protein-bsa-and-azide-free-ab172187.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling DNA / RNA DNA Damage & Repair Non Homol. End Joining
Share by email

Recombinant Human PRP19 protein (BSA and azide free) (ab172187)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human PRP19 protein (BSA and azide free) (ab172187)

    Key features and details

    • Expression system: Baculovirus infected Sf9 cells
    • Purity: > 90% Densitometry
    • Tags: proprietary tag N-Terminus
    • Suitable for: WB, SDS-PAGE

    You may also be interested in

    Protein
    Product image
    Recombinant human GM-CSF protein (Active) (ab259376)
    Protein
    Product image
    Recombinant human GDNF protein (Active) (ab259417)
    Protein
    Recombinant mouse Macrophage Inflammatory Protein 1 alpha / CCL3 (ab9928)

    View more associated products

    Description

    • Product name

      Recombinant Human PRP19 protein (BSA and azide free)
    • Purity

      > 90 % Densitometry.
      Affinity purified.
    • Expression system

      Baculovirus infected Sf9 cells
    • Accession

      NM_014502
    • Protein length

      Full length protein
    • Animal free

      No
    • Carrier free

      Yes
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        SLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQ LIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQ ELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQP SVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKP EELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDK SSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQV VRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGC SLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFS ENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLA LGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKF YSL
      • Predicted molecular weight

        55 kDa
      • Amino acids

        2 to 504
      • Tags

        proprietary tag N-Terminus

    Associated products

    • Related Products

      • Anti-PRP19 antibody [EPR7446] (ab126776)

    Specifications

    Our Abpromise guarantee covers the use of ab172187 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Western blot

      SDS-PAGE

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

      pH: 7.50
      Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine)

    General Info

    • Alternative names

      • hPso4
      • NMP200
      • Nuclear matrix protein 200
      • Nuclear matrix protein NMP200 related to splicing factor PRP19
      • pre mRNA processing factor 19
      • Pre-mRNA-processing factor 19
      • PRP19
      • PRP19/PSO4 homolog
      • PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
      • PRP19_HUMAN
      • PRPF19
      • PSO4
      • psoralen 4
      • Senescence evasion factor
      • SNEV
      • UBOX4
      see all
    • Function

      Plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. Binds double-stranded DNA in a sequence-nonspecific manner. Acts as a structural component of the nuclear framework. May also serve as a support for spliceosome binding and activity. Essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. May have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process. Overexpression of PRPF19 might extend the cellular life span by increasing the resistance to stress or by improving the DNA repair capacity of the cells.
    • Tissue specificity

      Ubiquitous. Weakly expressed in senescent cells of different tissue origins. Highly expressed in tumor cell lines.
    • Sequence similarities

      Belongs to the WD repeat PRP19 family.
      Contains 1 U-box domain.
      Contains 7 WD repeats.
    • Cellular localization

      Nucleus. Nucleus > nucleoplasm. Cytoplasm > cytoskeleton > spindle. Nucleoplasmic in interphase cells. Irregularly distributed in anaphase cells. In prophase cells, uniformly distributed, but not associated with condensing chromosomes. Found in extrachromosomal regions in metaphase cells. Mainly localized to the mitotic spindle apparatus when chromosomes segregate during anaphase. When nuclei reform during late telophase, uniformly distributed in daughter cells and displays no preferred association with decondensing chromatin.
    • Target information above from: UniProt accession Q9UMS4 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human PRP19 protein (BSA and azide free) (ab172187)
      SDS-PAGE - Recombinant Human PRP19 protein (BSA and azide free) (ab172187)

      SDS-PAGE showing ab172187. Approx. MW ~74kDa.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab172187? Please let us know so that we can cite the reference in this datasheet.

    ab172187 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab172187.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2023 Abcam plc. All rights reserved.