Description

  • Product name

    Recombinant Human PRPF31 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKT IAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLT VEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCK NNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNAS KHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIM LLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCT LAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQ RKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLG KSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTAS SVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST
    • Predicted molecular weight

      82 kDa including tags
    • Amino acids

      1 to 499

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp566J153
    • hPrp 31
    • hPrp31
    • NY BR 99
    • Pre mRNA processing factor 31
    • Pre mRNA processing factor 31 homolog
    • Pre mRNA processing factor 31 homolog (yeast)
    • Pre-mRNA-processing factor 31
    • Precursor mRNA-processing factor 31, S. cerevisiae, homolog of
    • Protein 61K
    • PRP 31
    • PRP31
    • PRP31 pre mRNA processing factor 31 homolog
    • PRP31 pre mRNA processing factor 31 homolog (yeast)
    • PRP31_HUMAN
    • PRPF 31
    • prpf31
    • RP 11
    • RP11
    • Serologically defined breast cancer antigen NY BR 99
    • Serologically defined breast cancer antigen NY-BR-99
    • SNRNP61
    • U4/U6 small nuclear ribonucleoprotein Prp31
    • U4/U6 snRNP 61 kDa protein
    see all
  • Function

    Involved in pre-mRNA splicing. Required for U4/U6.U5 tri-snRNP formation.
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Defects in PRPF31 are the cause of retinitis pigmentosa type 11 (RP11) [MIM:600138]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP11 inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the PRP31 family.
    Contains 1 Nop domain.
  • Domain

    Interacts with the snRNP via the Nop domain.
    The coiled coil domain is formed by two non-contiguous helices.
  • Cellular localization

    Nucleus speckle. Nucleus > Cajal body. Predominantly found in speckles and in Cajal bodies.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131853 stained with Coomassie Blue.

References

ab131853 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up