Description

  • Product name

    Recombinant Human PRPF4 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGI LGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQIN VSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKK DDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHK EIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATAC WSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCA ADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLW DLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCI MFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQN LVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDI SSDGQLIATCSYDRTFKLWMAE
    • Amino acids

      1 to 522
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hPrp4
    • HPRP4P
    • PRP4
    • PRP4 homolog
    • PRP4 pre mRNA processing factor 4 homolog (yeast)
    • PRP4/STK/WD splicing factor
    • PRP4_HUMAN
    • Prp4p
    • PRPF4
    • RP70
    • SNRNP60
    • U4/U6 small nuclear ribonucleoprotein Prp4
    • U4/U6 snRNP 60 kDa protein
    • WD splicing factor Prp4
    see all
  • Function

    Participates in pre-mRNA splicing. Part of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome.
  • Sequence similarities

    Contains 7 WD repeats.
  • Cellular localization

    Nucleus speckle. Colocalizes with spliceosomal snRNPs.
  • Information by UniProt

Images

  • ab160348 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160348 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up