Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAARATTPADGEEPAPEAEALAAARERSSRFLSGLELVKQGAEARVFRG RFQGRAAVIKHRFPKGYRHPALEARLGRRRTVQEARALLRCRRAGISAPV VFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLSNLAKTIGQVL ARMHDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDL YVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRS MVG
    • Molecular weight
      28 kDa including tags
    • Amino acids
      1 to 253
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab169728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.04% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • C20orf64
    • Nori 2
    • Nori 2p
    • Nori-2
    • p53 related protein kinase
    • p53-related protein kinase
    • PRPK_HUMAN
    • TP53 regulating kinase
    • TP53-regulating kinase
    • TP53RK
    see all
  • Function
    Protein kinase that phosphorylates 'Ser-15' of p53/TP53 protein and may therefore participate in its activation.
  • Tissue specificity
    Highly expressed in testis. Weakly expressed in heart kidney and spleen.
  • Sequence similarities
    Belongs to the protein kinase superfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • The purity of ab169728 was determined by SDS-PAGE.

References

ab169728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up