Description

  • Product name

    Recombinant Human PRPS2 protein
    See all PRPS2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMPNIVLFSGSSHQDLSQRVADRLGLEL GKVVTKKFSNQETSVEGESVRGEDVYIIQSGCGEINDNLMELLIMINACK IASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHII TMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGA KRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADT CGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTI PQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 321
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Corresponds to Isoform 2

Specifications

Our Abpromise guarantee covers the use of ab201899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.02% DTT, 10% Glycerol, 89% PBS

General Info

  • Alternative names

    • EC 2.7.6.1
    • Phosphoribosyl pyrophosphate synthase II
    • phosphoribosyl pyrophosphate synthetase 2
    • Phosphoribosyl pyrophosphate synthetase II
    • PPRibP
    • Prps2
    • PRPS2_HUMAN
    • PRS II
    • PRS-II
    • Ribose phosphate pyrophosphokinase II
    • Ribose-phosphate pyrophosphokinase 2
    see all
  • Function

    Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.
  • Pathway

    Metabolic intermediate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate from D-ribose 5-phosphate (route I): step 1/1.
  • Sequence similarities

    Belongs to the ribose-phosphate pyrophosphokinase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE of 3μg of ab201899.

References

ab201899 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201899.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up