Description

  • Product name

    Recombinant Human PRPS2 protein (Tagged)
    See all PRPS2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Expressed in E.coli as inclusion bodies. The final product was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFPNIVLFSGSSHQDLSQRVADR LGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLI MINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGAD HIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDA GGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDM ADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVT NTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      2 to 318
    • Additional sequence information

      Recombinant full length protein without starter Methionine, constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab199576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, Sucrose and DTT.

General Info

  • Alternative names

    • EC 2.7.6.1
    • Phosphoribosyl pyrophosphate synthase II
    • phosphoribosyl pyrophosphate synthetase 2
    • Phosphoribosyl pyrophosphate synthetase II
    • PPRibP
    • Prps2
    • PRPS2_HUMAN
    • PRS II
    • PRS-II
    • Ribose phosphate pyrophosphokinase II
    • Ribose-phosphate pyrophosphokinase 2
    see all
  • Function

    Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.
  • Pathway

    Metabolic intermediate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate from D-ribose 5-phosphate (route I): step 1/1.
  • Sequence similarities

    Belongs to the ribose-phosphate pyrophosphokinase family.
  • Information by UniProt

References

ab199576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up