Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ VYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIME
    • Amino acids

      1 to 88
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 41 kDa phosphoribosypyrophosphate synthetase associated protein
    • 41 kDa phosphoribosypyrophosphate synthetase-associated protein
    • KPRB
    • KPRB_HUMAN
    • MGC117304
    • MGC126719
    • MGC126721
    • PAP41
    • Phosphoribosyl pyrophosphate synthase-associated protein 2
    • Phosphoribosyl pyrophosphate synthetase associated protein 2
    • PRPP synthase-associated protein 2
    • PRPP synthetase associated protein 2
    • Prpsap2
    see all
  • Function

    Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the ribose-phosphate pyrophosphokinase family.
  • Information by UniProt

Images

  • ab159238 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up