Overview

  • Product name
    Recombinant Human PRR7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQN LRALELEPLELEGSLAGSPPGLAPPQPPPHRSRLEAPAHAHSHPHVHVHP LLHHGPAQPHAHAHPHPHHHALPHPPPTHLSVPPRPWSYPRQAESDMSKP PCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPS YKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSS REPLEHGAWRLPVSIPLFGRTTAV
    • Amino acids
      1 to 274
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164286 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Proline rich protein 7
    • Proline-rich protein 7
    • Prr7
    • PRR7_HUMAN
    • Synaptic proline rich membrane protein
    • Synaptic proline-rich membrane protein
    • transmembrane adaptor protein 3
    • TRAP3
    see all
  • Cellular localization
    Membrane. Cell junction > synapse > postsynaptic cell membrane. Enriched in post-synaptic plasma membrane and postsynaptic densities (PSD). Accumulates in spines along with synapse maturation and colocalizes with DLG4 in a punctate pattern.
  • Information by UniProt

Images

  • ab164286 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164286 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164286.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up