Description

  • Product name

    Recombinant Human PRRT2 protein
  • Purity

    > 85 % SDS-PAGE.
    ab177630 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAASSSEISEMKGVEESPKVPGEGPGH SEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVDSGPKAGLAPETTETPAG ASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATADQGSRLE SAAPPEPAPEPAPQPDPRPDSQPTPKPALQPELPTQEDPTPEILSESVGE KQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDR MRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDY
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      1 to 268
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001243372.1.

Specifications

Our Abpromise guarantee covers the use of ab177630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • interferon induced transmembrane protein domain containing 1
    • BFIC2
    • BFIS2
    • Dispanin subfamily B member 3
    • DSPB3
    • Dystonia 10
    • DYT10
    • EKD1
    • FICCA
    • FLJ25513
    • ICCA
    • IFITMD1
    • Infantile convulsions and paroxysmal choreoathetosis
    • PKC
    • Proline rich transmembrane protein 2
    • Proline-rich transmembrane protein 2
    • PRRT2
    • PRRT2_HUMAN
    see all
  • Involvement in disease

    Episodic kinesigenic dyskinesia 1 (EKD1) [MIM:128200]: An autosomal dominant neurologic condition characterized by recurrent and brief attacks of abnormal involuntary movements, triggered by sudden voluntary movement. These attacks usually have onset during childhood or early adulthood and can involve dystonic postures, chorea, or athetosis. Note=The disease is caused by mutations affecting the gene represented in this entry. Disease-causing mutations that produce truncation of the C-terminus of the protein alter subcellular location, from plasma membrane to cytosplasm (PubMed:22101681).
    Convulsions, familial infantile, with paroxysmal choreoathetosis (ICCA) [MIM:602066]: A syndrome characterized by clinical features of benign familial infantile seizures and episodic kinesigenic dyskinesia. Benign familial infantile seizures is a disorder characterized by afebrile seizures occurring during the first year of life, without neurologic sequelae. Paroxysmal choreoathetosis is a disorder of involuntary movements characterized by attacks that occur spontaneously or are induced by a variety of stimuli. Note=The disease is caused by mutations affecting the gene represented in this entry.
    Seizures, benign familial infantile 2 (BFIS2) [MIM:605751]: An autosomal dominant disorder in which afebrile seizures occur in clusters during the first year of life, without neurologic sequelae. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the CD225/Dispanin family.
  • Cellular localization

    Cell membrane. Cell junction > synapse.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177630 (3 µg).

    Note: Molecular weight on SDS-PAGE will appear higher.

References

ab177630 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up