Description

  • Product name

    Recombinant Human PRSS1 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCY KSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSS RAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPV LSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVS WGDGCAQKNKPGVYTKVYNYVKWIKNTIAANSVDDIEGRMDEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      16 to 247
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 16 to 247. The signal peptide is not included. FC-6His tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab191806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 1.19% HEPES, 0.87% Sodium chloride, 0.03% DTT, 10% Glycerol

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names

    • Alpha-trypsin chain 2
    • Beta-trypsin
    • Cationic trypsinogen
    • Digestive zymogen
    • Nonfunctional trypsin 1
    • Prss1
    • Serine protease 1
    • TCR V beta 4.1
    • TRP1
    • TRY1
    • TRY1_HUMAN
    • TRY4
    • TRYP1
    • Trypsin I
    • Trypsinogen 1
    • Trypsinogen A
    see all
  • Function

    Has activity against the synthetic substrates Boc-Phe-Ser-Arg-Mec, Boc-Leu-Thr-Arg-Mec, Boc-Gln-Ala-Arg-Mec and Boc-Val-Pro-Arg-Mec. The single-chain form is more active than the two-chain form against all of these substrates.
  • Involvement in disease

    Defects in PRSS1 are a cause of hereditary pancreatitis (HPC) [MIM:167800]; also known as chronic pancreatitis (CP). HPC is an autosomal dominant disease characterized by the presence of calculi in pancreatic ducts. It causes severe abdominal pain attacks.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    Occurs in a single-chain form and a two-chain form, produced by proteolytic cleavage after Arg-122.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

References

ab191806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up