Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTS RWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVY SWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGS IQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLE GERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHR SWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARSHHHHHH
    • Molecular weight

      32 kDa including tags
    • Amino acids

      33 to 317
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab151869 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. ab151869 was 0.2 µM filtered before lyophilization.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 4.50
    Constituents: Sodium Acetate Buffer, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Brain specific serine protease 4
    • BSSP 4
    • BSSP4
    • hBSSP 4
    • MGC9599
    • Prosemin
    • Protease serine 22
    • Protease serine S1 family member 22
    • PRSS 22
    • PRSS26
    • Serine protease 22
    • Serine protease 26
    • SP001LA
    • Tryptase epsilon
    see all
  • Relevance

    PRSS22 is a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. It preferentially cleaves the synthetic substrate H-D-Leu-Thr-Arg-pNA compared to tosyl-Gly-Pro-Arg-pNA.
  • Cellular localization

    Secreted

References

ab151869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up