Description

  • Product name

    Recombinant Human PRSS35 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MENMLLWLIFFTPGWTLIDGSEMEWDFMWHLRKVPRIVSERTFHLTSPAF EADAKMMVNTVCGIECQKELPTPSLSELEDYLSYETVFENGTRTLTRVKV QDLVLEPTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKL STGCSGILISPQHVLTAAHCVHDGKDYVKGSKKLRVGLLKMRNKSGGKKR RGSKRSRREASGGDQREGTREHLQERAKGGRRRKKSGRGQRIAEGRPSFQ WTRVKNTHIPKGWARGGMGDATLDYDYALLELKRAHKKKYMELGISPTIK KMPGGMIHFSGFDNDRADQLVYRFCSVSDESNDLLYQYCDAESGSTGSGV YLRLKDPDKKNWKRKIIAVYSGHQWVDVHGVQKDYNVAVRITPLKYAQIC LWIHGNDANCAYG
    • Amino acids

      1 to 413
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6030424L22Rik
    • C6orf158
    • Inactive serine protease 35
    • MGC46520
    • P3D9
    • protease, serine, 35
    • PRSS 35
    see all
  • Relevance

    PRSS35, although related to the peptidase S1 family, lacks the conserved active Ser residue in position 346 which is replaced by a Thr, suggesting that it has no protease activity. This Ser to Thr substitution may play an important role in determining a unique pattern of substrate specificity for PRSS35. Alternatively, this substitution may yield an inactive protease that binds to specific substrates, thus protecting them from proteolysis. The Mouse Prss35 gene is selectively expressed in the ovary and it's expression prior to ovulation is, in part, regulated by progesterone. PRSS35 may be involved in ovulation and the formation and regression of the corpus luteum.
  • Cellular localization

    Secreted

Images

  • ab165796 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165796 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up