Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFELIVGGYTCEENSLPYQVSLN SGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAK IIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLIS GWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGG KDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDT IAANS
    • Molecular weight

      28 kDa including tags
    • Amino acids

      81 to 304
    • Additional sequence information

      Mature protein constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab185590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab185590 was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as PRSS3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • Brain trypsinogen
    • Mesotrypsin
    • Mesotrypsinogen
    • MTG
    • Pancreatic trypsinogen III
    • Protease, serine, 3
    • Protease, serine, 4 (trypsin 4, brain)
    • PRSS3
    • PRSS4
    • Serine protease 3
    • Serine protease 4
    • T9
    • TRY3
    • TRY3_HUMAN
    • TRY4
    • Trypsin 3
    • Trypsin III
    • Trypsin IV
    • Trypsin-3
    • Trypsinogen 4
    • Trypsinogen 5
    • Trypsinogen IV
    see all
  • Function

    Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.
  • Tissue specificity

    Expressed in pancreas and brain. Also expressed in Paneth cells, at the base of small intestinal crypts.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab185590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up