Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      TFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKF RRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSW
    • Amino acids

      110 to 202
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PRRX2. 

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Paired mesoderm homeobox protein 2
    • Paired related homeobox protein 2
    • paired-like homeobox gene 2
    • paired-like homeodomain protein PRX2
    • Paired-related homeobox protein 2
    • PMX2
    • Predicted NUP98/PRRX2 fusion protein
    • Prrx2
    • PRRX2_HUMAN
    • PRX 2
    • PRX-2
    • PRX2
    see all
  • Function

    May play a role in the scarless healing of cutaneous wounds during the first two trimesters of development.
  • Tissue specificity

    In fetal skin, highest expression found in cells of mesodermal origin within the dermal papilla of the developing hair shaft. Not detected in epidermis or dermis. In adult skin, weakly expressed within the basal layers of the epidermis. Not expressed in dermis.
  • Sequence similarities

    Belongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage

    Higher expression in fetus than in adult.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162560 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up