Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ASGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKSLPCD ICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYL PVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDM TEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRT NSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEI CALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVY CEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTY GSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKK LVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIE ILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNA VEHCKRHVWNKLHHHHHH
    • Molecular weight

      58 kDa including tags
    • Amino acids

      17 to 524
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. Includes an N-terminal linker (extra amino acids AS).

Specifications

Our Abpromise guarantee covers the use of ab203534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Western blot

  • Endotoxin level

    < 1.000 Eu/µg
  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 95 % SDS-PAGE.
    Assessed by densitometry. Purifed using Ni-NTA chromatography.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.44% Sodium chloride

    Lyophilized from a 0.4 µM filtered solution.

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

General Info

  • Alternative names

    • A1 activator
    • Cerebroside sulfate activator
    • Co-beta-glucosidase
    • Component C
    • CSAct
    • Dispersin
    • GLBA
    • Glucosylceramidase activator
    • Proactivator polypeptide
    • Proactivator polypeptide precursor
    • Prosaposin
    • Prosaposin (sphingolipid activator protein 1)
    • prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy)
    • Protein A
    • Protein C
    • PSAP
    • SAP 1
    • SAP 2
    • SAP-1
    • SAP-2
    • SAP_HUMAN
    • SAP1
    • Saposin A
    • Saposin B
    • Saposin B Val
    • Saposin C
    • Saposin D
    • Saposin-D
    • Saposins
    • Sgp1
    • Sphingolipid activator protein 1
    • Sphingolipid activator protein 2
    • Sulfated glycoprotein 1
    • Sulfatide/GM1 activator
    see all
  • Function

    The lysosomal degradation of sphingolipids takes place by the sequential action of specific hydrolases. Some of these enzymes require specific low-molecular mass, non-enzymic proteins: the sphingolipids activator proteins (coproteins).
    Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.
    Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.
    Saposin-D is a specific sphingomyelin phosphodiesterase activator (EC 3.1.4.12).
  • Involvement in disease

    Defects in PSAP are the cause of combined saposin deficiency (CSAPD) [MIM:611721]; also known as prosaposin deficiency. CSAPD is due to absence of all saposins, leading to a fatal storage disorder with hepatosplenomegaly and severe neurological involvement.
    Defects in PSAP saposin-B region are the cause of leukodystrophy metachromatic due to saposin-B deficiency (MLD-SAPB) [MIM:249900]. MLD-SAPB is an atypical form of metachromatic leukodystrophy. It is characterized by tissue accumulation of cerebroside-3-sulfate, demyelination, periventricular white matter abnormalities, peripheral neuropathy. Additional neurological features include dysarthria, ataxic gait, psychomotr regression, seizures, cognitive decline and spastic quadriparesis.
    Defects in PSAP saposin-C region are the cause of atypical Gaucher disease (AGD) [MIM:610539]. Affected individuals have marked glucosylceramide accumulation in the spleen without having a deficiency of glucosylceramide-beta glucosidase characteristic of classic Gaucher disease, a lysosomal storage disorder.
    Defects in PSAP saposin-A region are the cause of atypical Krabbe disease (AKRD) [MIM:611722]. AKRD is a disorder of galactosylceramide metabolism. AKRD features include progressive encephalopathy and abnormal myelination in the cerebral white matter resembling Krabbe disease.
    Note=Defects in PSAP saposin-D region are found in a variant of Tay-Sachs disease (GM2-gangliosidosis).
  • Sequence similarities

    Contains 2 saposin A-type domains.
    Contains 4 saposin B-type domains.
  • Post-translational
    modifications

    This precursor is proteolytically processed to 4 small peptides, which are similar to each other and are sphingolipid hydrolase activator proteins.
    N-linked glycans show a high degree of microheterogeneity.
    The one residue extended Saposin-B-Val is only found in 5% of the chains.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • 12% SDS-PAGE analysis of ab203534.

    Lane 1: Reduced and boiled sample, 2.5 μg/lane
    Lane 2: Non-reduced and non-boiled sample, 2.5 μg/lane

    The ~66KDa band corresponds to whole PSAP molecule that consists of four saposin units. The individual saposins naturally cleave off the prosaposin which results in ~15, ~35 and ~50 kDa fragments of mono-, di- and trisaposins, respectively.

References

ab203534 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up