Overview

  • Product name

    Recombinant Human PSD3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSWCLYGCCNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEA AKRLAKRLYQLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQ SLRYFFKAFSLVGETQERERVLIHFSNRYFYCNPDTIASQDGVHCLTCAI MLLNTDLHGHNIGKKMTCQEFIANLQGVNEGVDFSKDLLKALYNSIKNEK LEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGSTTNPFLDIPHDPNAA VYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEK ALSEEDLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEE MQGWINKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKS HESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEMYV SILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKD HRPETPSIKQKVT
    • Molecular weight

      85 kDa including tags
    • Amino acids

      1 to 513

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADP ribosylation factor guanine nucleotide factor 6
    • DKFZp761K1423
    • EFA 6R
    • EFA6R
    • Epididymis tissue protein Li 20mP
    • Exchange factor for ADP ribosylation factor guanine nucleotide factor 6
    • HCA 67
    • HCA67
    • Hepatocellular carcinoma associated antigen 67
    • KIAA0942
    • PH and SEC7 domain containing protein 3
    • Pleckstrin and Sec7 domain containing 3
    • Pleckstrin and Sec7 domain containing protein 3
    • Pleckstrin homology and SEC7 domain containing protein 3
    • PSD 3
    • PSD3 protein
    see all
  • Relevance

    PSD3 is a guanine nucleotide exchange factor (GEF) specific for ARF6-like protein. The gene is potential tumour suppressor or antagonising gene candidate for ovarian carcinoma.
  • Cellular localization

    Cell junction, synapse, postsynaptic cell membrane, postsynaptic density (By similarity).

Images

  • 12.5% SDS-PAGE analysis of a132423 stained with Coomassie Blue.

References

ab132423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up