Description

  • Product name

    Recombinant Human PSD95 protein
    See all PSD95 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLS ESQKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGT EGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQ DGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEK VMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQ IGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAP PDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDI PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGD QILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDL REQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFG DVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDW GSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPD KFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSH LYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLEN VLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRV IEDLSGPYIWVPARERL
    • Predicted molecular weight

      112 kDa including tags
    • Amino acids

      1 to 767

Specifications

Our Abpromise guarantee covers the use of ab131874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Discs large homolog 4
    • Disks large homolog 4
    • DLG 4
    • Dlg4
    • DLG4_HUMAN
    • FLJ97752
    • FLJ98574
    • Human post synaptic density protein 95
    • Post synaptic density protein 95
    • Postsynaptic density protein 95
    • PSD 95
    • PSD-95
    • PSD95
    • SAP 90
    • SAP-90
    • SAP90
    • Synapse associated protein 90
    • Synapse-associated protein 90
    • Tax interaction protein 15
    see all
  • Function

    Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B.
  • Tissue specificity

    Brain.
  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Domain

    The PDZ domain 3 mediates interaction with ADR1B.
    The L27 domain near the N-terminus of isoform 2 is required for HGS/HRS-dependent targeting to postsynaptic density.
  • Post-translational
    modifications

    Palmitoylation of isoform 1 is required for targeting to postsynaptic density.
  • Cellular localization

    Cell membrane. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection, axon. Cell junction, synapse. High levels in postsynaptic density of neurons in the forebrain. Also in presynaptic region of inhibitory synapses formed by cerebellar basket cells on axon hillocks of Purkinje cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131874 stained with Coomassie Blue.

References

ab131874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up