Description

  • Product name

    Recombinant Human PSG1 (BSA and azide free) (denatured)
    See all PSG1 proteins and peptides
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSQVTIEAEPTKVSEGKDVLLLVHNLPQN LTGYIWYKGQMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQN VTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLETPKPSISSSNLNPRET MEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKYT AGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFT CEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCE IRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPP AQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTV EVSGKWIP
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      35 to 419
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_008836
  • Description

    Recombinant Human PSG1 protein (BSA and azide free)

Specifications

Our Abpromise guarantee covers the use of ab180312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Pregnancy Specific Glycoprotein 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names

    • B1G1
    • Carcinoembryonic antigen SG8
    • CD66 antigen-like family member F
    • CD66f
    • CD66f antigen
    • CEA
    • DHFRP2
    • Fetal liver non-specific cross-reactive antigen 1/2
    • FL-NCA-1/2
    • PBG 1
    • PBG1
    • Pregnancy specific B 1 glycoprotein
    • Pregnancy specific beta 1 glycoprotein
    • Pregnancy specific beta 1 glycoprotein 1
    • Pregnancy specific beta 1 glycoprotein 2
    • Pregnancy specific beta 1 glycoprotein 7
    • Pregnancy specific beta 1 glycoprotein 8
    • Pregnancy specific beta 1 glycoprotein C/D
    • Pregnancy-specific beta-1 glycoprotein C/D
    • Pregnancy-specific beta-1-glycoprotein 1
    • Pregnancy-specific glycoprotein 1
    • PS beta C/D
    • PS-beta-C/D
    • PS-beta-G-1
    • PSBG 1
    • PSBG 2
    • PSBG-1
    • PSBG1
    • PSBG2
    • PSG 1
    • PSG 2
    • PSG 8
    • PSG 95
    • PSG IIA d
    • PSG1
    • PSG1_HUMAN
    • PSG2
    • PSG8
    • PSG95
    • PSGGA
    • PSGGB
    • PSGIIA
    • PSGIIA a
    • PSGIIA b
    • PSGIIA c
    • SP 1
    • SP1
    see all
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    PSBG are produced in high quantity during pregnancy.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180312 (3 µg).

References

ab180312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up