Description

  • Product name

    Recombinant Human PSG1 protein (Tagged-His Tag)
    See all PSG1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab192278 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRDLYHYITSYVV DGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGV TGRFTFTLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNG QSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLN LLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSP RVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDL PRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHI TTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVPVDHHHHHH
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      35 to 419
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 35 to 419. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab192278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Pregnancy Specific Glycoprotein 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Dissolve protein in 1 x PBS to a concentration no less than 100ug/ml

General Info

  • Alternative names

    • B1G1
    • Carcinoembryonic antigen SG8
    • CD66 antigen-like family member F
    • CD66f
    • CD66f antigen
    • CEA
    • DHFRP2
    • Fetal liver non-specific cross-reactive antigen 1/2
    • FL-NCA-1/2
    • PBG 1
    • PBG1
    • Pregnancy specific B 1 glycoprotein
    • Pregnancy specific beta 1 glycoprotein
    • Pregnancy specific beta 1 glycoprotein 1
    • Pregnancy specific beta 1 glycoprotein 2
    • Pregnancy specific beta 1 glycoprotein 7
    • Pregnancy specific beta 1 glycoprotein 8
    • Pregnancy specific beta 1 glycoprotein C/D
    • Pregnancy-specific beta-1 glycoprotein C/D
    • Pregnancy-specific beta-1-glycoprotein 1
    • Pregnancy-specific glycoprotein 1
    • PS beta C/D
    • PS-beta-C/D
    • PS-beta-G-1
    • PSBG 1
    • PSBG 2
    • PSBG-1
    • PSBG1
    • PSBG2
    • PSG 1
    • PSG 2
    • PSG 8
    • PSG 95
    • PSG IIA d
    • PSG1
    • PSG1_HUMAN
    • PSG2
    • PSG8
    • PSG95
    • PSGGA
    • PSGGB
    • PSGIIA
    • PSGIIA a
    • PSGIIA b
    • PSGIIA c
    • SP 1
    • SP1
    see all
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    PSBG are produced in high quantity during pregnancy.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab192278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up