Description

  • Product name

    Recombinant Human PSG2 protein
  • Purity

    > 95 % SDS-PAGE.
    Assessed also by SEC-HPLC
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDLYHYITSYVV DGQIIIYGPAYSGRE TAYSNASLLIQNVTREDAGSYTLHIIKRGDGTRGVTGYFTFTLYLETPKP SISSSNLNPREAMET VILTCDPETPDTSYQWWMNGQSLPMTHRFQLSETNRTLFLFGVTKYTAGP YECEIRNSGSASRSD PVTLNLLHGPDLPRIHPSYTNYRSGDNLYLSCFANSNPPAQYSWTINGKF QQSGQNLFIPQITTK HSGLYVCSVRNSATGEESSTSLTVKVSASTRIGLLPLLNPTVDHHHHHH
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      35 to 335
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature form.

Specifications

Our Abpromise guarantee covers the use of ab185849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names

    • Pregnancy-specific beta-1 glycoprotein E
    • Pregnancy-specific beta-1-glycoprotein 2
    • Pregnancy-specific glycoprotein 2
    • PS-beta-E
    • PS-beta-G-2
    • PSBG-2
    • PSG2
    • PSG2_HUMAN
    see all
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab185849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up