Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGPLSAPPCTQRITWKGLLLTALLLNFWNLPTTAQVTIEAEPTKVSKGKD VLLLVHNLPQNLAGYIWYKGQMKDLYHYITSYVVDGQIIIYGPAYSGRET VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS ISSSNLYPREDMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLQLSKNKR TLFLFGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLN PRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSV TRNETGPYQCEIQDRYGGIRSYPVTLNVLYGPDLPRIYPSFTYYHSGENL YLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTKHSGLYACSVRNSA TGMESSKSMTVEVSAPSGTGHLPGLNPL
    • Amino acids

      1 to 428
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159252 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • carcinoembryonic antigen SG5
    • pregnancy specific beta-1-glycoprotein 3
    • Pregnancy specific glycoprotein 3
    • PS-beta-G-3
    • PSBG 3
    • PSBG3
    see all
  • Relevance

    The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes. Members of the CEA family consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. Most PSGs have an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain.
  • Cellular localization

    Secreted

Images

  • ab159252 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159252 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up