Description

  • Product name

    Recombinant Human PSG3 protein
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QVTIEAEPTKVSKGKDVLLLVHNLPQNLAGYIWYKGQMKDLYHYITSYVV DGQIIIYGPAYSGRETVYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGE TGHFTFTLYLETPKPSISSSNLYPREDMEAVSLTCDPETPDASYLWWMNG QSLPMTHSLQLSKNKRTLFLFGVTKYTAGPYECEIRNPVSASRSDPVTLN LLPKLPKPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSP RVKRPIENRILILPSVTRNETGPYQCEIQDRYGGIRSYPVTLNVLYGPDL PRIYPSFTYYHSGENLYLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQI TTKHSGLYACSVRNSATGMESSKSMTVEVSAPSGTGHLPGLNPLVDHHHH HH
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      35 to 428
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 35 to 428. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Dissolve lyophilized protein in 1XPBS to a concentration no less than 100ug/ml.

General Info

  • Alternative names

    • carcinoembryonic antigen SG5
    • pregnancy specific beta-1-glycoprotein 3
    • Pregnancy specific glycoprotein 3
    • PS-beta-G-3
    • PSBG 3
    • PSBG3
    see all
  • Relevance

    The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes. Members of the CEA family consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. Most PSGs have an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain.
  • Cellular localization

    Secreted

References

ab191940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up