Description

  • Product name

    Recombinant Human PSG5 protein
    See all PSG5 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQLMDLYHYITSYVV DGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGV TGYFTFNLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNG QSLPVSPRVKQPIENRILILPSVTRNETGPYECEIRDRDGGMHSDPVTLN VLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQQSGQ KLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNP IVDHHHHHH
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      35 to 335
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab192284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Reconstitute for long term storage.

    pH: 7.4
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Lyophilized protein should be stored at < -20°C.

General Info

  • Alternative names

    • Fetal liver non specific cross reactive antigen 3
    • Fetal liver non-specific cross-reactive antigen 3
    • FL NCA 3
    • FL-NCA-3
    • Pregnancy specific beta 1 glycoprotein 5 [Precursor]
    • pregnancy specific beta-1-glycoprotein 5
    • pregnancy-specific beta 1 glycoprotein
    • Pregnancy-specific beta-1-glycoprotein 5
    • Pregnancy-specific glycoprotein 5
    • PS-beta-G-5
    • PSBG 5
    • PSBG-5
    • PSG
    • PSG5
    • PSG5_HUMAN
    see all
  • Tissue specificity

    Synthesized by syncytiotrophoblast of the placenta.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    PSBG are produced in high quantity during pregnancy.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab192284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up