Description

  • Product name

    Recombinant Human PSG5 protein (His tag)
    See all PSG5 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab223096 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADLQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQLMDLYHYITS YVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRT RGVTGYFTFNLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWW LNGQSLPVSPRVKRPIENRILILPSVTRNETGPYECEIRDRDGGMRSDPV TLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQQ SGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPL LNPIHHHHHH
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      35 to 335
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 35 to 335. The signal peptide is not included (NP_001123486).

Specifications

Our Abpromise guarantee covers the use of ab223096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 6.80
    Constituents: 0.02% DTT, 40% Glycerol, 0.24% Tris

General Info

  • Alternative names

    • Fetal liver non specific cross reactive antigen 3
    • Fetal liver non-specific cross-reactive antigen 3
    • FL NCA 3
    • FL-NCA-3
    • Pregnancy specific beta 1 glycoprotein 5 [Precursor]
    • pregnancy specific beta-1-glycoprotein 5
    • pregnancy-specific beta 1 glycoprotein
    • Pregnancy-specific beta-1-glycoprotein 5
    • Pregnancy-specific glycoprotein 5
    • PS-beta-G-5
    • PSBG 5
    • PSBG-5
    • PSG
    • PSG5
    • PSG5_HUMAN
    see all
  • Tissue specificity

    Synthesized by syncytiotrophoblast of the placenta.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    PSBG are produced in high quantity during pregnancy.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab223096.

References

ab223096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up