Description

  • Product name

    Recombinant Human PSG9 protein
    See all PSG9 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab191984 is supplied as a 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTDLYHYIISYIV DGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREE IRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNG QSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLN LLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSP GVKRPIENRILILPSVTRNETGPYQCEIQDRYGGLRSNPVILNVLYGPDL PRIYPSFTYYRSGENLDLSCFTESNPPAEYFWTINGKFQQSGQKLFIPQI TRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGDLTESQSVDHHHHHH
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      35 to 426
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 35 to 426. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

General Info

  • Alternative names

    • pregnancy specific beta 1 glycoprotein (PSG)
    • pregnancy specific beta 1 glycoprotein 11
    • pregnancy specific beta 1 glycoprotein 9
    • pregnancy specific beta 1 glycoprotein B
    • Pregnancy-specific beta-1 glycoprotein B
    • Pregnancy-specific beta-1-glycoprotein 11
    • Pregnancy-specific beta-1-glycoprotein 9
    • Pregnancy-specific glycoprotein 11
    • Pregnancy-specific glycoprotein 7
    • Pregnancy-specific glycoprotein 9
    • PS beta B
    • PS-beta-B
    • PS-beta-G-11
    • PS-beta-G-9
    • PS34
    • PSBG 9
    • PSBG-11
    • PSBG-9
    • PSG 9
    • PSG11
    • PSG7
    • PSG9
    • PSG9_HUMAN
    • PSGII
    see all
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    PSBG are produced in high quantity during pregnancy.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab191984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up