Description

  • Product name

    Recombinant Human PSMC5 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRN ELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVD KNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEM IGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLA RAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDE IDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEL MPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMS IKKLWK
    • Amino acids

      1 to 406
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 26S protease regulatory subunit 8
    • 26S proteasome AAA-ATPase subunit RPT6
    • Cim3
    • MSUG1 protein
    • p45
    • p45/SUG
    • Proteasome 26S ATPase subunit 5
    • Proteasome 26S subunit ATPase 5
    • Proteasome prosome macropain 26S subunit ATPase 5
    • Proteasome subunit p45
    • PRS8_HUMAN
    • PSMC5
    • Rpt6
    • S8
    • SUG1
    • Tat binding protein homolog 10
    • TBP10
    • Thyroid hormone receptor interacting protein 1
    • Thyroid hormone receptor-interacting protein 1
    • Thyroid receptor interactor 1
    • TRIP1
    • TRIP1(SUG1)
    see all
  • Function

    The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.
  • Sequence similarities

    Belongs to the AAA ATPase family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab159258 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up