Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKAL QSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVAL DMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIE LPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVS SSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSAD REIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIH IDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEA GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
    • Molecular weight

      71 kDa including tags
    • Amino acids

      1 to 389

Specifications

Our Abpromise guarantee covers the use of ab132464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Reduced Glutathione

General Info

  • Alternative names

    • 26S protease regulatory subunit 10B
    • 26S protease regulatory subunit S10B
    • 26S proteasome AAA-ATPase subunit RPT4
    • CADP44
    • P44
    • Proteasome 26S subunit ATPase 6
    • Proteasome subunit p42
    • PRS10_HUMAN
    • PSMC6
    • Rpt4
    • SUG2
    see all
  • Function

    The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.
  • Sequence similarities

    Belongs to the AAA ATPase family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132464 on a 12.5% gel stained with Coomassie Blue.

References

ab132464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up