Overview

  • Product name

    Recombinant Human PSMD12 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSL EKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQA VAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLA TIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYI RTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAI YDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIP KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKR WKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNK TIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEE MIHNLQ
    • Amino acids

      1 to 456
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159270 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as 26S proteasome non-ATPase regulatory subunit 12

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 26S proteasome non-ATPase regulatory subunit 12
    • 26S proteasome regulatory subunit p55
    • 26S proteasome regulatory subunit RPN5
    • MGC75406
    • p55
    • proteasome (prosome, macropain) 26S subunit, non ATPase12
    • Proteasome 26S non ATPase subunit 12 isoform 2
    • PSD12_HUMAN
    • PSMD12
    • Rpn5
    see all
  • Function

    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similarities

    Belongs to the proteasome subunit p55 family.
    Contains 1 PCI domain.
  • Information by UniProt

Images

  • ab159270 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159270 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159270.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up