Description

  • Product name

    Recombinant Human PSMD13 protein (denatured)
    See all PSMD13 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMKDVPGFLQQSQNSGPGQPAVWHRLEE LYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLV EIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGD LQVTKETIED VEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKD LPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTL YAFNSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPAN HRQLTFEEIA KSAKITVNEV ELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLEFWC TDVKSMEMLVEHQAHDILT
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      1 to 376
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_002808.

Specifications

Our Abpromise guarantee covers the use of ab181912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • 26S proteasome non ATPase regulatory subunit 13
    • 26S proteasome non-ATPase regulatory subunit 13
    • 26S proteasome regulatory subunit p40.5
    • 26S proteasome regulatory subunit RPN9
    • 26S proteasome regulatory subunit S11
    • 26S proteasome subunit p40.5
    • HSPC027
    • P40.5
    • Proteasome (prosome, macropain) 26S subunit, non ATPase, 13
    • Proteasome 26S subunit, non-ATPase 13
    • PSD13_HUMAN
    • psmD13
    • Rpn9
    • S11
    see all
  • Function

    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similarities

    Belongs to the proteasome subunit S11 family.
    Contains 1 PCI domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab181912 (3µg).

References

ab181912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up