Overview

  • Product name

    Recombinant Human PSMD14 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKM TPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
    • Amino acids

      1 to 95
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 26S proteasome non-ATPase regulatory subunit 14
    • 26S proteasome regulatory subunit rpn11
    • 26S proteasome-associated PAD1 homolog
    • 26S proteasome-associated PAD1 homolog 1
    • PAD1
    • PAD1, yeast, homolog of
    • POH1
    • Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
    • Proteasome 26S subunit non ATPase 14
    • PSDE_HUMAN
    • Psmd14
    • RPN11
    • Testis tissue sperm binding protein Li 69n
    see all
  • Function

    Metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The function of the 'Lys-63'-specific deubiquitination of the proteasome is unclear.
  • Tissue specificity

    Widely expressed. Highest levels in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the peptidase M67A family. PSMD14 subfamily.
    Contains 1 MPN (JAB/Mov34) domain.
  • Information by UniProt

Images

  • ab160883 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up