Description

  • Product name

    Recombinant Human PSMD5 protein
  • Purity

    > 90 % SDS-PAGE.
    ab207131 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEFMAAQALALLREVARLEAPLEELRAL HSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILERLLQAM EPVHVARNLRVDLQRGLIHPDDSVKILTLSQIGRIVENSDAVTEILNNAE LLKQIVYCIGGENLSVAKAAIKSLSRISLTQAGLEALFESNLLDDLKSVM KTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVTQLLRELTGEDVLVRA TCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVK FFGNLAVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSN VEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQ QTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTAIANQP WAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGN PNYLRLRTYLSEGPYYVKPVSTTAVEGAE
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      1 to 504
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_005038.

Specifications

Our Abpromise guarantee covers the use of ab207131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Proteasome 26S S5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 89% PBS, 10% Glycerol

General Info

  • Alternative names

    • 26S protease subunit S5 basic
    • 26S proteasome non-ATPase regulatory subunit 5
    • 26S proteasome subunit S5B
    • Protease 26S, subunit 5B
    • Proteasome (prosome, macropain) 26S subunit, non ATPase, 5
    • Proteasome 19S S5B
    • Proteasome 26S subunit, non ATPase, 5
    • PSMD5
    • PSMD5_HUMAN
    • S5B
    see all
  • Function

    Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD5:PSMC2:PSMC1:PSMD2 module which probably assembles with a PSMD10:PSMC4:PSMC5:PAAF1 module followed by dissociation of PSMD5.
  • Sequence similarities

    Belongs to the proteasome subunit S5B/HSM3 family.
  • Domain

    Rich in dileucine repeats, which have been implicated in trafficking of a variety of transmembrane proteins.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab207131.

References

ab207131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up