Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDV SNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPK LHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTP TSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKG LNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFY LKTNDQMVVVYLASLIRSVVALHNLINNKIADRDAEKKEGQEKEESKKDR KEDKEKDKDKEKSDVKKEEKKEKK
    • Amino acids
      1 to 324
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S proteasome non ATPase regulatory subunit 7
    • 26S proteasome non-ATPase regulatory subunit 7
    • 26S proteasome regulatory subunit RPN8
    • 26S proteasome regulatory subunit S12
    • integration site gene, mouse, homolog of
    • Moloney leukemia virus 34 proviral
    • Moloney leukemia virus 34 proviral integration
    • MOV34
    • Mov34 homolog
    • Mov34 protein homolog
    • MOV34L
    • P40
    • Proteasome (prosome, macropain) 26S subunit, non ATPase 7
    • Proteasome (prosome, macropain) 26S subunit, non ATPase, 7 (Mov34 homolog)
    • Proteasome 26S S12
    • Proteasome 26S subunit, no-ATPase, 7
    • Proteasome subunit p40
    • PSD7_HUMAN
    • PSMD 7
    • PSMD7
    • Rpn8
    • S12
    see all
  • Function
    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similarities
    Belongs to the peptidase M67A family.
    Contains 1 MPN (JAB/Mov34) domain.
  • Information by UniProt

Images

  • ab159267 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159267 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up