Description

  • Product name

    Recombinant Human PSMD9 protein
  • Purity

    > 90 % SDS-PAGE.
    ab137154 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSDEEARQSGGSSQAGVVTVSDVQELM RRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARH NIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQS ESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIG SVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      1 to 223
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • 26S proteasome non ATPase regulatory subunit 9
    • 26S proteasome non-ATPase regulatory subunit 9
    • 26S proteasome regulatory subunit p27
    • Homolog of rat Bridge 1
    • MGC8644
    • p27
    • Proteasome (prosome macropain) 26S subunit non ATPase 9
    • Proteasome 26S non ATPase regulatory subunit 9
    • Proteasome 26S subunit non ATPase 9
    • PSMD 9
    • Psmd9
    • PSMD9_HUMAN
    • Rpn4
    see all
  • Function

    Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). During the base subcomplex assembly is part of an intermediate PSMD9:PSMC6:PSMC3 module, also known as modulator trimer complex; PSMD9 is released during the further base assembly process.
  • Tissue specificity

    Expressed in all tissues tested, highly expressed in liver and kidney.
  • Sequence similarities

    Belongs to the proteasome subunit p27 family.
    Contains 1 PDZ (DHR) domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137154.

References

ab137154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up