Description

  • Product name

    Recombinant Human PSME1 protein
    See all PSME1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab99961 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAMLRVQPEAQAKVDVFREDLCTKTENLLG SYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQ QEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNL VTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDII LKNFEKLKKPRGETKGMIY
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      1 to 249
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 11S regulator complex alpha subunit
    • 11S regulator complex subunit alpha
    • 29 kD MCP activator subunit
    • 29kD MCP activator subunit
    • Activator of multicatalytic protease subunit 1
    • IFI5111
    • IGUP I-5111
    • Interferon gamma IEF SSP 5111
    • Interferon gamma inducible protein 5111
    • Interferon gamma up regulated I 5111 protein
    • Interferon gamma up-regulated I-5111 protein
    • MGC8628
    • PA28a
    • PA28alpha
    • Proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
    • Proteasome activator 28 subunit alpha
    • Proteasome activator complex subunit 1
    • Proteasome activator subunit 1
    • PSME1
    • PSME1_HUMAN
    • REG-alpha
    • REGalpha
    see all
  • Function

    Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
  • Sequence similarities

    Belongs to the PA28 family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99961 (3 µg) at approximately 30.8 kDa.

References

ab99961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up