Description

  • Product name

    Recombinant Human PSME2 protein (His tag)
    See all PSME2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDS LNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVL SLLALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGVAIQEKVLERVN AVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVHERDEAAYGE LRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      2 to 239
    • Tags

      His tag N-Terminus
    • Additional sequence information

      AAH04368.

Specifications

Our Abpromise guarantee covers the use of ab221321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 11S regulator complex beta subunit
    • 11S regulator complex subunit beta
    • Activator of multicatalytic protease subunit 2
    • Cell migration inducing protein 22
    • MCP activator 31 kD subunit
    • PA28 beta
    • PA28b
    • PA28beta
    • Proteasome (prosome macropain) activator subunit 2
    • Proteasome (prosome macropain) activator subunit 2 (PA28 beta)
    • Proteasome activator 28 beta
    • Proteasome activator 28 subunit beta
    • Proteasome activator complex subunit 2
    • Proteasome activator hPA28 subunit beta
    • Proteasome activator subunit 2
    • PSME 2
    • PSME2
    • PSME2_HUMAN
    • REG beta
    • REG-beta
    • REGbeta
    see all
  • Function

    Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
  • Sequence similarities

    Belongs to the PA28 family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab221321 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 31 kDa in SDS-PAGE.

References

ab221321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up