Overview

  • Product name

    Recombinant Human PSMF1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKK SELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQ VADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKAN VSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDP FGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIG TSPPGPNPDHLPPPGYDDMYL
    • Molecular weight

      30 kDa including tags
    • Amino acids

      1 to 271
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NM_006814).

Specifications

Our Abpromise guarantee covers the use of ab206175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    = 85 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Proteasome Inhibitor subunit 1 PI3 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 0.87% Sodium chloride, 0.02% Beta mercaptoethanol, 10% Glycerol

General Info

  • Alternative names

    • hPI31
    • PI31
    • Proteasome (prosome macropain) inhibitor subunit 1
    • Proteasome inhibitor hP131 subunit
    • Proteasome inhibitor PI31 subunit
    • PSMB2
    • Psmf1
    • PSMF1_HUMAN
    • RP23 402M7.5
    • RP4 545L17.1
    see all
  • Function

    Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28.
  • Sequence similarities

    Belongs to the proteasome inhibitor PI31 family.
  • Information by UniProt

References

ab206175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up